Protein Info for ABZR87_RS00805 in Ralstonia sp. UNC404CL21Col

Annotation: glycerol-3-phosphate 1-O-acyltransferase PlsY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00023: acyl-phosphate glycerol 3-phosphate acyltransferase
  • amino acids 7 to 202 (196 residues), 193.1 bits, E=2.3e-61
• PF02660: G3P_acyltransf
  • amino acids 13 to 192 (180 residues), 181 bits, E=9.4e-58

Best Hits

Swiss-Prot: 98% identical to PLSY_RALPJ: Glycerol-3-phosphate acyltransferase (plsY) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K08591, glycerol-3-phosphate acyltransferase PlsY [EC: 2.3.1.15] (inferred from 99% identity to rpf:Rpic12D_2417)

Predicted SEED Role

"Acyl-phosphate:glycerol-3-phosphate O-acyltransferase PlsY" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria

MetaCyc Pathways

• phosphatidylglycerol biosynthesis I (6/6 steps found)
• phosphatidylglycerol biosynthesis II (6/6 steps found)
• superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
• CDP-diacylglycerol biosynthesis I (4/4 steps found)
• CDP-diacylglycerol biosynthesis II (4/4 steps found)
• oleate biosynthesis III (cyanobacteria) (2/3 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (9/13 steps found)
• phosphatidate biosynthesis (yeast) (3/5 steps found)
• diacylglycerol and triacylglycerol biosynthesis (3/7 steps found)
• palmitoyl ethanolamide biosynthesis (2/6 steps found)
• superpathway of stearidonate biosynthesis (cyanobacteria) (2/6 steps found)
• stigma estolide biosynthesis (2/7 steps found)
• anandamide biosynthesis II (2/8 steps found)
• anandamide biosynthesis I (3/12 steps found)
• superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)

KEGG Metabolic Maps

• Glycerolipid metabolism
• Glycerophospholipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.15

Use Curated BLAST to search for 2.3.1.15

Protein Sequence (207 amino acids)

>ABZR87_RS00805 glycerol-3-phosphate 1-O-acyltransferase PlsY (Ralstonia sp. UNC404CL21Col)
MSPVVATVIFAVAAYLIGSISFAVVVSRAMGLADPRTYGSGNPGATNVLRSGNKKAAILT
LLGDAAKGWLAVWLAQWLAARFGVDETGIALVVIAVFLGHLFPVFHRFEGGKGVATAAGI
LLALNVWLGLATLATWLIIAVFFRYSSLAALVSAVFAPFFYVLMNGFDWIAGAVALMAVL
LIARHRANIAKLLAGKESRIGEKKKTA