Protein Info for ABZR87_RS00755 in Ralstonia sp. UNC404CL21Col

Annotation: bile acid:sodium symporter family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 44 to 61 (18 residues), see Phobius details amino acids 75 to 97 (23 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 137 to 160 (24 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details amino acids 211 to 231 (21 residues), see Phobius details amino acids 237 to 259 (23 residues), see Phobius details amino acids 289 to 309 (21 residues), see Phobius details PF13593: SBF_like" amino acids 14 to 325 (312 residues), 352.7 bits, see alignment E=2e-109 PF01758: SBF" amino acids 49 to 222 (174 residues), 39.8 bits, see alignment E=4.1e-14

Best Hits

Swiss-Prot: 48% identical to Y2026_PSEAE: Uncharacterized protein PA2026 (PA2026) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K14347, solute carrier family 10 (sodium/bile acid cotransporter), member 7 (inferred from 98% identity to rpi:Rpic_2813)

Predicted SEED Role

"Sodium/bile acid symporter family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (343 amino acids)

>ABZR87_RS00755 bile acid:sodium symporter family protein (Ralstonia sp. UNC404CL21Col)
MKIPLLSPLLSQIDGFIRAMLVMVALALFFPALGASDGPLRLDIVTIVGVSLVFFLHGAA
LSREKIVEGARNWRLHLFVQSCTFILFPLIGAVILFVCKPFIPAELLLGVFYLCALPSTV
SSSVAMTAMAKGNVPAAIFNATISGLIGMIATPLLMSFVIQASGADLSVGKALLGVAEQL
LLPFVLGQLLRPVIGGFINKHKAIINKVDRAVILLIVFNSFADSTHAGVWSKYPWETIVA
VAVMSGALLFVVLGATTWLSRRAGFSLADEITAVFCGSKKSLANGVPMAKILFAGNPALG
LIVLPLMIYHQLQLIVCSTLARRYADRVAHAEASAGVPASRAA