Protein Info for ABZR87_RS00640 in Ralstonia sp. UNC404CL21Col

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 36 to 56 (21 residues), see Phobius details amino acids 63 to 89 (27 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details amino acids 127 to 153 (27 residues), see Phobius details amino acids 173 to 191 (19 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details amino acids 254 to 275 (22 residues), see Phobius details amino acids 287 to 308 (22 residues), see Phobius details amino acids 320 to 339 (20 residues), see Phobius details amino acids 351 to 371 (21 residues), see Phobius details amino acids 385 to 407 (23 residues), see Phobius details amino acids 414 to 433 (20 residues), see Phobius details PF00083: Sugar_tr" amino acids 27 to 235 (209 residues), 85 bits, see alignment E=5.4e-28 amino acids 235 to 432 (198 residues), 43.8 bits, see alignment E=1.7e-15 PF07690: MFS_1" amino acids 41 to 339 (299 residues), 113.6 bits, see alignment E=1e-36 amino acids 303 to 433 (131 residues), 42.2 bits, see alignment E=5.1e-15

Best Hits

KEGG orthology group: K03762, MFS transporter, MHS family, proline/betaine transporter (inferred from 100% identity to rpf:Rpic12D_2384)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (443 amino acids)

>ABZR87_RS00640 MFS transporter (Ralstonia sp. UNC404CL21Col)
MQATAAPTQGDRAPAPAISAATRRKAIIAATIGNGLEWFDFTVYSFFAVIIAKLFFPTGN
DFTSFMLTVATFGVGFFMRPVGAVVLGIYADRVGRKAALTLTIMLMAIGTAIIGLAPTYA
QIGIGAPILIVIARLIQGFSAGGEVGGATAFLIEYSPDERRGYFASWQQASQGISFILGA
AMGAIVTNGLSPEQIDAWGWRIPFLFGLLIGPVGMYIRSHLHEPPAFEAQKAKAAKESRL
APLSQVLRDHPREVLGGLGVTILWTVCTYTLVFYMPTYAKQQLGLPLGATFQSTALCGAI
IFVLCPLMGTLSDRIGRKRMLGTVALIIAAAAYPLFHWLNVHPTVQTLLQVQVILGVLLA
AFTGPAPAVLAEQFPTAVRSTGLSISYNLAVTIFGGFAPLIVTWLIASSGSKLAPSYYVM
AAAIISVFALSLMHDRTGKPIEK