Protein Info for ABZR87_RS00530 in Ralstonia sp. UNC404CL21Col

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 transmembrane" amino acids 38 to 56 (19 residues), see Phobius details amino acids 62 to 87 (26 residues), see Phobius details amino acids 97 to 116 (20 residues), see Phobius details amino acids 122 to 145 (24 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details amino acids 197 to 216 (20 residues), see Phobius details amino acids 248 to 269 (22 residues), see Phobius details amino acids 281 to 303 (23 residues), see Phobius details amino acids 312 to 332 (21 residues), see Phobius details amino acids 338 to 356 (19 residues), see Phobius details amino acids 377 to 399 (23 residues), see Phobius details amino acids 411 to 429 (19 residues), see Phobius details PF00083: Sugar_tr" amino acids 29 to 234 (206 residues), 67.6 bits, see alignment E=1.1e-22 amino acids 241 to 424 (184 residues), 36.5 bits, see alignment E=2.7e-13 PF07690: MFS_1" amino acids 72 to 292 (221 residues), 65.2 bits, see alignment E=5.1e-22 amino acids 288 to 433 (146 residues), 47.8 bits, see alignment E=1e-16

Best Hits

KEGG orthology group: K03762, MFS transporter, MHS family, proline/betaine transporter (inferred from 100% identity to rpf:Rpic12D_2363)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (438 amino acids)

>ABZR87_RS00530 MFS transporter (Ralstonia sp. UNC404CL21Col)
MTAPSAAGTAAPARPATTSAAHARRIVISSSIGNALEWYDFLVYGFFASVIGKLFFPADD
EWVSLLFAVGSFGVSFITRPVGAIVLGMYADRKGRKAALTLSILLMIVGTLAIAVMPSYQ
QIGIVAPITILLARLVQGFAVGGEFGSATAFMVEHSTRGRGYYASWQFASQGIATILAAG
LGALLTASLTPTDLEGWGWRLPFVFGLLVGPVGFYIRRHLDETPEFVAEQKKTTVDPQAS
FKAQWTNLLLAVGVVAQSTVSVYVLQLYMPTYAVKQLHLPAAQSFAVVVLNGGLQFLLSP
VMGALSDRIGRIRIMLTTSVLMILLIYPMFALLRAYPTIGALLALQAVSGIFKAAYSGPM
PALMSEIFPTRVRSTGLSLGYSLGVTLFGGFAPFIVTWLIHTTGDTLAPSYYVLTAAAVS
GISLTIIALRRRKAVRAA