Protein Info for ABZR87_RS00510 in Ralstonia sp. UNC404CL21Col

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 518 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 60 to 79 (20 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 149 to 167 (19 residues), see Phobius details amino acids 179 to 199 (21 residues), see Phobius details amino acids 223 to 242 (20 residues), see Phobius details amino acids 254 to 271 (18 residues), see Phobius details amino acids 292 to 311 (20 residues), see Phobius details amino acids 330 to 352 (23 residues), see Phobius details amino acids 359 to 379 (21 residues), see Phobius details amino acids 386 to 407 (22 residues), see Phobius details amino acids 427 to 445 (19 residues), see Phobius details amino acids 496 to 513 (18 residues), see Phobius details PF06609: TRI12" amino acids 17 to 278 (262 residues), 42.8 bits, see alignment E=3.9e-15 PF07690: MFS_1" amino acids 31 to 436 (406 residues), 106.2 bits, see alignment E=2.8e-34 PF00083: Sugar_tr" amino acids 62 to 199 (138 residues), 43.2 bits, see alignment E=4e-15

Best Hits

KEGG orthology group: None (inferred from 96% identity to rpf:Rpic12D_2359)

Predicted SEED Role

"FIG00973953: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (518 amino acids)

>ABZR87_RS00510 MFS transporter (Ralstonia sp. UNC404CL21Col)
MSLQILKPASLRAFPHFSSARVHAFGLAMGLSTGLDFVSSQMFAVAGQHIQGGVHASPDA
YLYAVTAYAVAAVVANLAIGRIAAHVGYRMYSLVGIVLFAIGCVVCAQSNNIGELVIGRT
IQGLGAGGLFSASRILVQLTAEPDERIPPMLMFSVGLFGLTTIAPWICAEVLEYSEWRVI
FWIELVLAGVAWMAVFFLPPEHHQPRTRAARRPDEAPPQQSRWDWIGVGAMAIGALSFLM
GLSELRYSRLTASPVIPLLLLGGTASLLLAIHRLRTHPDPWLDLSRLNGRRYLWGIGFYG
VYYLMSGYWSYLFPAVSQGGLGFTFRTTTLFLMISGAVSTVVAVVMTIWLPFFFRKRRFI
AMGFAVYAAAALVLGTSLMPGAPDYAFFPVSMLEGITPGAVMIQVAMMTYLDLDREDFAH
GYQMKNIARQFATAVGTGLAAVSLQTQQAESRSLIVAHVTRFTSDLQTMNPMTPERLASL
SAEIDRQATLLAGTQLFSWFAVACGLFAVLVLVQRSLR