Protein Info for ABZR87_RS00430 in Ralstonia sp. UNC404CL21Col

Annotation: dUTP diphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 TIGR00576: dUTP diphosphatase" amino acids 10 to 147 (138 residues), 155 bits, see alignment E=5.3e-50 PF00692: dUTPase" amino acids 15 to 146 (132 residues), 121.8 bits, see alignment E=7.8e-40

Best Hits

Swiss-Prot: 99% identical to DUT_RALPJ: Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K01520, dUTP pyrophosphatase [EC: 3.6.1.23] (inferred from 99% identity to rpf:Rpic12D_2342)

MetaCyc: 66% identical to dUTP diphosphatase (Escherichia coli K-12 substr. MG1655)
dUTP diphosphatase. [EC: 3.6.1.23, 3.6.1.9]

Predicted SEED Role

"Deoxyuridine 5'-triphosphate nucleotidohydrolase (EC 3.6.1.23)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.23 or 3.6.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (148 amino acids)

>ABZR87_RS00430 dUTP diphosphatase (Ralstonia sp. UNC404CL21Col)
MKLDVKILDARLHEQLPQYATTGSAGLDLRACIDAPLTIEPGTTHLIPTGMAIHLADPGY
AALILPRSGMGHKHGIVLGNLVGLIDSDYQGQLMVSTWNRGSTAFVLNPMERLAQLVIVP
VVQAELNIVDDFAESERGAGGFGSTGRH