Protein Info for ABZR87_RS00390 in Ralstonia sp. UNC404CL21Col

Annotation: hybrid sensor histidine kinase/response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 610 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 35 to 56 (22 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 130 to 149 (20 residues), see Phobius details amino acids 154 to 173 (20 residues), see Phobius details amino acids 180 to 198 (19 residues), see Phobius details PF00512: HisKA" amino acids 235 to 298 (64 residues), 46.2 bits, see alignment E=5.9e-16 PF02518: HATPase_c" amino acids 347 to 453 (107 residues), 79.7 bits, see alignment E=3.3e-26 PF00072: Response_reg" amino acids 485 to 593 (109 residues), 62.1 bits, see alignment E=8.3e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpi:Rpic_2724)

Predicted SEED Role

"FOG: CheY-like receiver"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (610 amino acids)

>ABZR87_RS00390 hybrid sensor histidine kinase/response regulator (Ralstonia sp. UNC404CL21Col)
MNASLRLFFAKFGLASRAPLELDARAKLLAAVHRGAPMGIAASVVLPALTVAAFWDASNR
PGLLGWCLIMLCLTASGLRFYFGYRYDLTRMTLAAHTRKWWTGMHVMSAVGGVAWGCSAG
LYLMSPSLEFSSLLMIVIIGVAAAAVLSQAPVPSSLLILGTGILAPHFVLAEQAFPGHGL
YLRGVLLFFAALLTRHAVNIHNTLVREIQLENESRQLARRYQDEKQRALSASEEKSRFLA
AASHDLRQPVHAIVLLVEALRARNQSESLAPLVEQLASGAATIDLLFRSLLDLSKLESRK
TSPTLEPVDLGEVITEVVQQFMPDARAKGLTLAARIPPLPVFGMAEPVLLRRALFNLLQN
ALRYTERGGVMVALRVRQKHLRIEVWDTGIGIAPEHQKDIFSTYYQVENPERDPSQGLGL
GLSIYKECVRLLRGTFGVRSVPGRGSMFWMALRPVPAEIKAPLATQPRAEQKRAVLDQPR
FSGVVLVVDDDPQIRKAWHALLEAWGVEVHSAADGRSAEQLLARGIRPQIIFCDLRLPGE
EDGLQLLERWQVSHPDAHAVLLTGDRNSAALARAEEAGYLLLAKPMDPNMLRVLLKRWLR
GRSAEPQVAY