Protein Info for ABZR87_RS00280 in Ralstonia sp. UNC404CL21Col

Annotation: CDP-6-deoxy-delta-3,4-glucoseen reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00111: Fer2
  • amino acids 6 to 81 (76 residues), 63.8 bits, E=1.7e-21
• PF00970: FAD_binding_6
  • amino acids 105 to 203 (99 residues), 52.4 bits, E=8.5e-18
• PF00175: NAD_binding_1
  • amino acids 215 to 320 (106 residues), 75 bits, E=1.1e-24

Best Hits

KEGG orthology group: K00523, CDP-4-dehydro-6-deoxyglucose reductase [EC: 1.17.1.1] (inferred from 99% identity to rpf:Rpic12D_2312)

Predicted SEED Role

"CDP-6-deoxy-delta-3,4-glucoseen reductase-like"

MetaCyc Pathways

• CDP-4-dehydro-3,6-dideoxy-D-glucose biosynthesis (3/3 steps found)
• superpathway of CDP-glucose-derived O-antigen building blocks biosynthesis (3/8 steps found)

KEGG Metabolic Maps

• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.1.1

Protein Sequence (349 amino acids)

>ABZR87_RS00280 CDP-6-deoxy-delta-3,4-glucoseen reductase (Ralstonia sp. UNC404CL21Col)
MAYQINVLPSGRQFQAEDGETILAAALRQGIGLPYGCKNGACGSCKGQVREGSIVQGNHS
PNALTAQEATEGRALFCCATPATDVTIEVREVHGAGDVPIKKIPCRVASLEKAAPDVTIV
KLQLPATERMQFLAGQYVEFLLRDGKRRSYSIANPPHDDGPIELHIRHMPGGAFTDYVFG
AKEGAPAMKERDILRFEGPLGSFFLREESDKPIILLASGTGFAPIKAIIEHAQFIGSTRP
MTLYWGGRRPQDLYMHAKAEEWARTLPNFTYVPVVSNALPEDAWTGRTGFVHQAVMADYP
DLSGHEVYACGAPVVINSARTDFAAQCGMHPDAFFADSFTSEADLHPAG