Protein Info for ABZR87_RS00270 in Ralstonia sp. UNC404CL21Col

Annotation: sensor domain-containing diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 554 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 347 to 368 (22 residues), see Phobius details PF02743: dCache_1" amino acids 60 to 279 (220 residues), 48.1 bits, see alignment E=1.1e-16 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 392 to 552 (161 residues), 150.4 bits, see alignment E=1.9e-48 PF00990: GGDEF" amino acids 395 to 550 (156 residues), 146.5 bits, see alignment E=6.1e-47

Best Hits

KEGG orthology group: None (inferred from 96% identity to rpf:Rpic12D_2310)

Predicted SEED Role

"FIG00974082: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (554 amino acids)

>ABZR87_RS00270 sensor domain-containing diguanylate cyclase (Ralstonia sp. UNC404CL21Col)
MKVPAPAPTSSHGARLRIARWALWLSAALVGVGVSWFAACFVADSMSARDVQQMVDARRQ
LGAQVAEGMSSQITADVALLRALPQTLAQIDAIPRAVQRVDTRRWNLMDQGSRAEQAMSH
PEVVDIDAFLNATAGNLGLDYVWVVNQNNYVVLANNAGRADSFVGVQSSMQPYMKEAMLG
GLGEQFTVGRVTGVPGLFFAAPVYDAGGYLIAVMGTKVSLARLQHWVSHPTSLVTDPNGL
IILSTDASLVGKILPDARLQRMGASDRYNAYQRVDFEPWPYQPTAKAHPDVPSWVPAEVR
DTLAWREGSAIPSLTVSRNASADLTVVVAEPLPAWGQQIANHARNRMIGFVLFVSVLATF
VLVAWSLVRERQHHRVTRHLNQRLQRTNSALANEAHFDHLTGVLTRRRFLALFDTVLARA
HNRAEPLVLVLADLDHFKRINDTWGHAVGDMALQRFASLATGVLRSSDLVGRLGGEEFAM
VMGRTTLETATEVAERLRTAVAESDESFPTGLSMTVSMGMTVCRPGDTASEMLKRADLAL
YRAKESGRNRHVAG