Protein Info for ABZR87_RS00265 in Ralstonia sp. UNC404CL21Col

Annotation: chloride channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 605 transmembrane" amino acids 21 to 48 (28 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 141 to 159 (19 residues), see Phobius details amino acids 166 to 194 (29 residues), see Phobius details amino acids 201 to 220 (20 residues), see Phobius details amino acids 231 to 253 (23 residues), see Phobius details amino acids 272 to 290 (19 residues), see Phobius details amino acids 310 to 331 (22 residues), see Phobius details amino acids 337 to 357 (21 residues), see Phobius details amino acids 364 to 391 (28 residues), see Phobius details amino acids 397 to 417 (21 residues), see Phobius details PF00654: Voltage_CLC" amino acids 79 to 411 (333 residues), 265.6 bits, see alignment E=7.1e-83 PF00571: CBS" amino acids 446 to 504 (59 residues), 26.8 bits, see alignment 5.2e-10 amino acids 520 to 566 (47 residues), 22.7 bits, see alignment 1e-08

Best Hits

KEGG orthology group: None (inferred from 96% identity to rpi:Rpic_2699)

Predicted SEED Role

"Chloride channel protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (605 amino acids)

>ABZR87_RS00265 chloride channel protein (Ralstonia sp. UNC404CL21Col)
MHNVEHPQHRRDFATDTTLFRTTALAVVIAAFATLAATVLLHLIRFFTNLFFFQTLSLAD
RSPATNTLGAWVIAVPLIGGLVVGLMARFGSEKIRGHGIPEAIEAILFGKSKMSPKVAVL
KPLSSGVVIGSGGPFGAEGPIIMTGGAIGSLFAQFFKLTAAERKTLLVAGATAGMTAVFG
TPVAALLLAVELLLFEWRPRSMLPVAVACAVAGFLRVLVLEPGPLFPLETAPATLPALGS
CVIAGLLCGALARSLSMALYKTEDLFGRLPIHWMWWPAIGGLVVGIGGYFEPRALGVGYD
VIGDLLHNHLAIRVALALLVVKAIIWVIALGSGTSGGVLAPLLMMGAGLGVLVGPVLPGG
DPGLWPLVCMAAMLAGVLGAPLTAIVFAFGLTHDVNALLPILLAVAVSYGFVVLTMPRSI
MTEKIARRGFHIYREYAVDPLERHAVDEVMTRSVQTIDAQATLADTLADRFGVRQAHRAF
PVVQGGPNGRLIGMLDRDALLAAQKRGAVTVAELFGANAPVMALPGETCRIVATRLAVHG
LERLPVVADSQSRALVGIVSRSDLVKPSLAFFDEEQRRERFRRVPLSGARTQLELRRRRA
GRAAR