Protein Info for ABZR87_RS00250 in Ralstonia sp. UNC404CL21Col

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 56 to 77 (22 residues), see Phobius details amino acids 84 to 102 (19 residues), see Phobius details amino acids 109 to 134 (26 residues), see Phobius details amino acids 142 to 164 (23 residues), see Phobius details amino acids 171 to 192 (22 residues), see Phobius details amino acids 213 to 236 (24 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details amino acids 280 to 298 (19 residues), see Phobius details amino acids 304 to 323 (20 residues), see Phobius details amino acids 341 to 361 (21 residues), see Phobius details amino acids 368 to 390 (23 residues), see Phobius details PF07690: MFS_1" amino acids 22 to 354 (333 residues), 133.2 bits, see alignment E=1.1e-42 PF00083: Sugar_tr" amino acids 52 to 190 (139 residues), 31.6 bits, see alignment E=8.7e-12

Best Hits

Swiss-Prot: 74% identical to YDHP_ECOLI: Inner membrane transport protein YdhP (ydhP) from Escherichia coli (strain K12)

KEGG orthology group: K08156, MFS transporter, DHA1 family, arabinose polymer transporter (inferred from 98% identity to rpi:Rpic_2696)

Predicted SEED Role

"Arabinose efflux permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (400 amino acids)

>ABZR87_RS00250 MFS transporter (Ralstonia sp. UNC404CL21Col)
MNSIQTSTERERSSATLPLLALAAGAFGIGTTEFSPMGLLPVIADGVHVSIPQAGMLISA
YAIGVMVGAPIMTLLLARWPRRKALIALMSIFTIGNLLSAVAPDYTTLLLARLVTSLNHG
AFFGLGSVVAASLVPREKQASAVATMFMGLTIANVGGVPAATWLGQMIGWRMSFAATASL
GLIAIAGLFTALPKGDAGKMPNLRAELAVLTRPVVLGALATTVLGAGAMFTLYTYVAPTL
AQLTGASPAFVTAMLVLIGIGFSIGNIAGGRLADRSLDGSLIGFLVLLIVTMLAFPVLAK
THVGAAAALLVWGIATFAVVPPLQMRVMRAAAEAPGLASSVNVGAFNLGNALGAAAGGAA
ISAGLGYAAVPIVGAVIAAAGLALVGLHVVQRRARLAMNP