Protein Info for ABZR87_RS00230 in Ralstonia sp. UNC404CL21Col

Annotation: NAD(P)-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 PF03807: F420_oxidored" amino acids 3 to 66 (64 residues), 39.4 bits, see alignment E=1.2e-13 PF03446: NAD_binding_2" amino acids 3 to 162 (160 residues), 176.2 bits, see alignment E=7.8e-56 PF14833: NAD_binding_11" amino acids 165 to 285 (121 residues), 94.7 bits, see alignment E=7.4e-31

Best Hits

Swiss-Prot: 38% identical to GARR_ECOL6: 2-hydroxy-3-oxopropionate reductase (garR) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 97% identity to rpf:Rpic12D_2233)

MetaCyc: 42% identical to tartronate semialdehyde reductase 2 (Escherichia coli K-12 substr. MG1655)
1.1.1.60,4.1.1.M27,4.1.1.73 [EC: 1.1.1.60, 4.1.1.73, 4.1.1.M27]

Predicted SEED Role

"2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60)" in subsystem Allantoin Utilization or D-galactarate, D-glucarate and D-glycerate catabolism or Photorespiration (oxidative C2 cycle) (EC 1.1.1.60)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.60, 4.1.1.73

Use Curated BLAST to search for 1.1.1.60 or 4.1.1.73 or 4.1.1.M27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (294 amino acids)

>ABZR87_RS00230 NAD(P)-dependent oxidoreductase (Ralstonia sp. UNC404CL21Col)
MTRIAFIGLGNMGTPMVQHLIAAGHTVRAYVRRPEAAHNARALGAEPVNTPAEAARDAEM
IFTNVTSTADVESVLLGPDGVIHGAPRGAVCIDHSTISAVATRRIAADLEAAGLEFLDAP
VSGGTAGAQKATLSIMVGGKADVLERVRPLLQLLGTTITHVGDHGAGQVAKACNQIVQVI
NIQGIAEAMLFARAQGTDPSRVLAAIGPGFAGSRMLDLEGPKMAERNFAAGIEARLHDKD
FGLVREIAQELGLQMPAMELVASQLNTLVANGWGYDDTASLLRVLEQQNNQQPD