Protein Info for ABZR87_RS00215 in Ralstonia sp. UNC404CL21Col

Annotation: sulfite exporter TauE/SafE family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 33 to 52 (20 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 102 to 121 (20 residues), see Phobius details amino acids 142 to 174 (33 residues), see Phobius details amino acids 211 to 229 (19 residues), see Phobius details amino acids 239 to 256 (18 residues), see Phobius details PF01925: TauE" amino acids 7 to 255 (249 residues), 153.8 bits, see alignment E=3.2e-49

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 98% identity to rpf:Rpic12D_2230)

Predicted SEED Role

"Putative sulfate permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (257 amino acids)

>ABZR87_RS00215 sulfite exporter TauE/SafE family protein (Ralstonia sp. UNC404CL21Col)
MTLAYTISGLLVGLLVGLTGVGGGSLMTPLLTLMFGFSPATAVGTDLAFASLTKGVGTIA
HRSHGHIRWDIVKRLCLGSLPAALVTVIVLKSAGNLDAEWMHVIRLTIGVSVILTVISLL
FRQRVLGWLARNPRYRLQGTTLAVATILVGAVLGVLVTVSSIGAGAVGATLILILYPELK
SAEVAGTDIAYAVPLTAVAGLGHMYLGTIDWNLLVSLLVGSIPGIWLGARLSKNLPERLV
RGALAATLTITAIKLVS