Protein Info for ABZR87_RS00190 in Ralstonia sp. UNC404CL21Col

Annotation: sulfate adenylyltransferase subunit 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02034: sulfate adenylyltransferase, large subunit
  • amino acids 11 to 431 (421 residues), 526.8 bits, E=2e-162
• PF00009: GTP_EFTU
  • amino acids 11 to 205 (195 residues), 135.7 bits, E=3e-43
• PF03144: GTP_EFTU_D2
  • amino acids 260 to 319 (60 residues), 33.8 bits, E=7.2e-12

Best Hits

Swiss-Prot: 49% identical to CYSN_CROS8: Sulfate adenylyltransferase subunit 1 (cysN) from Cronobacter sakazakii (strain ATCC BAA-894)

KEGG orthology group: K00956, sulfate adenylyltransferase subunit 1 [EC: 2.7.7.4] (inferred from 98% identity to rpf:Rpic12D_2225)

MetaCyc: 53% identical to sulfate adenylyltransferase large subunit (Allochromatium vinosum)
Sulfate adenylyltransferase. [EC: 2.7.7.4]

Predicted SEED Role

"Sulfate adenylyltransferase subunit 1 (EC 2.7.7.4)" in subsystem Cysteine Biosynthesis (EC 2.7.7.4)

MetaCyc Pathways

• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• assimilatory sulfate reduction I (4/4 steps found)
• assimilatory sulfate reduction III (3/3 steps found)
• sulfate activation for sulfonation (2/2 steps found)
• assimilatory sulfate reduction IV (3/4 steps found)
• assimilatory sulfate reduction II (2/3 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (7/10 steps found)
• sulfite oxidation III (1/3 steps found)
• selenate reduction (2/5 steps found)
• dissimilatory sulfate reduction I (to hydrogen sufide)) (1/5 steps found)
• superpathway of sulfur metabolism (Desulfocapsa sulfoexigens) (1/6 steps found)
• superpathway of thiosulfate metabolism (Desulfovibrio sulfodismutans) (1/6 steps found)
• superpathway of sulfide oxidation (phototrophic sulfur bacteria) (3/12 steps found)
• superpathway of seleno-compound metabolism (6/19 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Selenoamino acid metabolism
• Sulfur metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.4

Use Curated BLAST to search for 2.7.7.4

Protein Sequence (435 amino acids)

>ABZR87_RS00190 sulfate adenylyltransferase subunit 1 (Ralstonia sp. UNC404CL21Col)
MTNQASHQGLLRFITAGSVDDGKSTLIGRLLYDSKAVLTDQLQALANAKNKRTAGEQIDF
SLLTDGLEAEREQGITIDVAYRYFSTARRKFIIADTPGHEQYTRNMVTGASTAHAAIILI
DATRVTTVDGKTELLAQTKRHSAIVKLLELQHVIVAINKMDLVDYSEARFNEIRTAYDAL
ATQLGLHDVRYVPVSALRGDNIVHASEAMPWYQGEPLLALLEDLKVEETAPVGDDALRFP
VQLVARQDGSQADDFRGYMGRVEAGTVRVGQAVRVLPANRETTVAEVLTPNGSADAAGPG
ETITVRLADDVDISRGDTIVAAPTTAANAAKKLHADLCWFDEHELNPARKYVLKHTTATV
FARVSDVERVLDVHTLSHETGRKQIALNDIGTVNISLQKPIVCDVYGDNPATGAFILVDE
ATHHTVAAGMIRAFS