Protein Info for ABZR87_RS00165 in Ralstonia sp. UNC404CL21Col

Annotation: CbiX/SirB N-terminal domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01903: CbiX
  • amino acids 11 to 114 (104 residues), 88 bits, E=2.4e-29

Best Hits

KEGG orthology group: K03795, sirohydrochlorin cobaltochelatase [EC: 4.99.1.3] (inferred from 92% identity to rpi:Rpic_2682)

Predicted SEED Role

"Sirohydrochlorin cobaltochelatase (EC 4.99.1.3)" in subsystem Coenzyme B12 biosynthesis or Experimental tye (EC 4.99.1.3)

MetaCyc Pathways

• siroheme biosynthesis (3/4 steps found)
• factor 430 biosynthesis (3/7 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (20/36 steps found)
• cob(II)yrinate a,c-diamide biosynthesis I (early cobalt insertion) (4/15 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.99.1.3

Protein Sequence (123 amino acids)

>ABZR87_RS00165 CbiX/SirB N-terminal domain-containing protein (Ralstonia sp. UNC404CL21Col)
MAARALVLFAHGARDARWREPFDRLRERLATQQPNVDTRLAFLELMAPDLPGTIEDLAAK
GTRSITIVPVFFGQGGHLRRDLPALIAQCAQAHPTLSIRCVDAVGEDDAVLDAIAGYCVR
QLG