Protein Info for ABZR87_RS00160 in Ralstonia sp. UNC404CL21Col

Annotation: LPS export ABC transporter permease LptG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 39 to 57 (19 residues), see Phobius details amino acids 63 to 80 (18 residues), see Phobius details amino acids 101 to 120 (20 residues), see Phobius details amino acids 315 to 334 (20 residues), see Phobius details amino acids 341 to 362 (22 residues), see Phobius details amino acids 371 to 394 (24 residues), see Phobius details PF03739: LptF_LptG" amino acids 9 to 392 (384 residues), 252 bits, see alignment E=4.4e-79

Best Hits

KEGG orthology group: K11720, lipopolysaccharide export system permease protein (inferred from 99% identity to rpf:Rpic12D_2221)

Predicted SEED Role

"FIG000906: Predicted Permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (398 amino acids)

>ABZR87_RS00160 LPS export ABC transporter permease LptG (Ralstonia sp. UNC404CL21Col)
MMKMPVYEKYFARQIYGVFVFILFAVLALFIFFDMLGELGSVVGRYTTLVAFFHVMLQAP
TRVYEVIPVAALISAIYVFSQMASQSEFTIFRVAGLDTRRALLSLFKIALPLALVTYIFG
EFIGPKAEEYAQKVRLEALGATVSAGFRSGVWVKDRGPAKPDGTGGEVTRFVNVGALQPD
QSIKGLRIYEFDSDYRLSSIRVAEQARYQGHQNWQLNDVTETRFIEFPRKPGTVAPQDTV
QAVPGAPDALAPDFRGEQTKLPHQEMRSELTPQILSVLMVTPDRMATLDLFQYIRHLRDN
KQDTQRYEIALWKKVVYPFTVLVMMALALPFAYLHARAGAVGLKVFGGIMLGLSFQLVNN
LFSHVGLLNTWPAIFTAIVPGALYLALALVSLRWVERH