Protein Info for ABZR87_RS00090 in Ralstonia sp. UNC404CL21Col

Annotation: iron ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 transmembrane" amino acids 13 to 36 (24 residues), see Phobius details amino acids 70 to 91 (22 residues), see Phobius details amino acids 99 to 122 (24 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 159 to 181 (23 residues), see Phobius details amino acids 202 to 221 (20 residues), see Phobius details amino acids 246 to 273 (28 residues), see Phobius details amino acids 285 to 308 (24 residues), see Phobius details amino acids 316 to 335 (20 residues), see Phobius details PF01032: FecCD" amino acids 23 to 336 (314 residues), 268.9 bits, see alignment E=2.6e-84

Best Hits

Swiss-Prot: 39% identical to BTUC_SALTY: Vitamin B12 import system permease protein BtuC (btuC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 98% identity to rpf:Rpic12D_2208)

MetaCyc: 38% identical to vitamin B12 ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-5-RXN [EC: 7.6.2.8]; 7.6.2.8 [EC: 7.6.2.8]

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>ABZR87_RS00090 iron ABC transporter permease (Ralstonia sp. UNC404CL21Col)
MTTPALPARGFAWRLWSLLALACVVVLVASLMLGSVRLSPAEVWRALFFGNSGGDSLAAG
IVTELRLPRAGAAFAAGGLLAFAGALMQMLLRNPLADPYVLGVSGGGAVAALTAMLFSLP
WWAVQTSAGAGALLSMALVAALARQHLWRGEPGEANARLLLGGVVMASGWVGLITLILTV
APENKLRGMIFWMVGDLGGADRYAGALLALVAAVAVVLPHARDLNVLLTGETRARALGVP
VARVRALIYVVASLCTAVAVTIAGSVAFVGLLVPHMVRLAWTRDVRIHLPATAMAGGGLL
MLADLIARTLMAPTQLPVGVITTMLGVPTFLYLLMRSAR