Protein Info for ABZR87_RS00025 in Ralstonia sp. UNC404CL21Col

Annotation: ScpA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 PF02616: SMC_ScpA" amino acids 73 to 288 (216 residues), 122.3 bits, see alignment E=1.7e-39

Best Hits

KEGG orthology group: K05896, segregation and condensation protein A (inferred from 99% identity to rpi:Rpic_2599)

Predicted SEED Role

"Segregation and condensation protein A" in subsystem Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (293 amino acids)

>ABZR87_RS00025 ScpA family protein (Ralstonia sp. UNC404CL21Col)
MTTSAQDKLPLPVELPSVAPDQDSTPAQVDGLAFARLYGEPLFKLPQDLYIPPDALEVFL
EAFEGPLDLLLYLIRRQNFNVLDIPLAQVTRQYLAYIEQIRATNLELAAEYLLMAAMLIE
IKSRMLLPVKKTDEGVEPEDPRAELVRRLLEYEQMKLAAQKLDTVPQLGRDFLRAQVYIE
QSLAPRYPDVNSDDLRAAWADVLRRAKLTQHHKISREELSVREHMSQILRRLQHARFMEF
TELFEEAIQSGKGAPIVVVNFVAMLELSRESLLEITQAEPYAPIYVRLAYSPT