Protein Info for ABZR86_RS22205 in Dyella japonica UNC79MFTsu3.2

Annotation: chemotaxis response regulator protein-glutamate methylesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 PF00072: Response_reg" amino acids 6 to 110 (105 residues), 78.6 bits, see alignment E=4e-26 PF01339: CheB_methylest" amino acids 171 to 349 (179 residues), 205.5 bits, see alignment E=5.2e-65

Best Hits

KEGG orthology group: K03412, two-component system, chemotaxis family, response regulator CheB [EC: 3.1.1.61] (inferred from 64% identity to smt:Smal_1843)

Predicted SEED Role

"Chemotaxis response regulator protein-glutamate methylesterase CheB (EC 3.1.1.61)" in subsystem Bacterial Chemotaxis (EC 3.1.1.61)

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.61

Use Curated BLAST to search for 3.1.1.61

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2K2B4 at UniProt or InterPro

Protein Sequence (366 amino acids)

>ABZR86_RS22205 chemotaxis response regulator protein-glutamate methylesterase (Dyella japonica UNC79MFTsu3.2)
MSRVRVLVIDDSALVRKLLTTMLSCDPMIEVVGSAADPFIAREKIKQLEPDVLTLDVEMP
RMDGLTFLENLMRLRPMPVVMVSSLTQQGAEVTLRALELGAVDFFTKPSSDLASTFAEGA
QDICAKVKLAALARPRVRTAVRKLEVAPRLSADAVLPRAQTPDSRGGSPIIAIGASTGGT
EAIRVVLESMPPDAPPIVITQHIPAAFSGPFATRMDNCSAMRVCEARDGQPIQPGHAYIA
PGSQHLLVMWDGARHVCRLHDGPPVNRHKPSVDVLFRSMAATVGRTTVAALLTGMGDDGA
RGLLELKEAGAATVVQDEASSVVWGMPGAAWKLGAAAEMQSLEHIAARLLELARQPVASA
VRAASR