Protein Info for ABZR86_RS22045 in Dyella japonica UNC79MFTsu3.2

Annotation: tetratricopeptide repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 578 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF07721: TPR_4" amino acids 127 to 149 (23 residues), 12.1 bits, see alignment (E = 0.00021) amino acids 507 to 525 (19 residues), 10.7 bits, see alignment (E = 0.00059) PF13432: TPR_16" amino acids 131 to 187 (57 residues), 20 bits, see alignment 6.1e-07 amino acids 233 to 285 (53 residues), 24.7 bits, see alignment 2.1e-08 amino acids 404 to 464 (61 residues), 38.4 bits, see alignment E=1.1e-12 PF14559: TPR_19" amino acids 239 to 301 (63 residues), 36.3 bits, see alignment E=4.3e-12 amino acids 443 to 503 (61 residues), 25.9 bits, see alignment E=7.6e-09 PF13371: TPR_9" amino acids 406 to 468 (63 residues), 47.6 bits, see alignment E=1e-15 PF07719: TPR_2" amino acids 431 to 464 (34 residues), 27.9 bits, see alignment (E = 1.2e-09) PF13181: TPR_8" amino acids 432 to 464 (33 residues), 22.6 bits, see alignment (E = 6.5e-08) PF13174: TPR_6" amino acids 433 to 462 (30 residues), 18.8 bits, see alignment (E = 1.5e-06)

Best Hits

Predicted SEED Role

"FIG140336: TPR domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2JTG1 at UniProt or InterPro

Protein Sequence (578 amino acids)

>ABZR86_RS22045 tetratricopeptide repeat protein (Dyella japonica UNC79MFTsu3.2)
MLSRWAKFKQLRHFAICAIGLAVLAGCATAPGQQASRPASRQPLDHLAVVTPDTDHDLMA
QLLAGEMAIVRTDLKAATEAYAKAMALSNDPRVAQQATELATATHDTALAGRAIERWQEL
GAKPAELAMVRAQLALDRGDTDEANRQLDKLIATGDPDAWRRFGRVLLTSRDSAVAARLL
ESLATPQRLPADPQAWLAMSELGDKLGRHAYAQQLADAAIKRFNSAETYAWSAQLKYRNG
DRAGAQAMFQKALGREPKNASLRLAYATLLGQNGDYAQAAKVLDSGPQNTETYALRATLA
ARASDTKAIARIYAQLQRAPHDVRDGNGFLLGTLAEMLDKNDEALDWYSQVPDEDEHAFE
ADLRSAILLHKMARIGESHALLTQMQTDYLDQPAQLRRAYEVDASLYMAEQKFPMAEAAF
SRALQVVPDDPELLYGRGLAYAETGQTDKAVADFRRLLQLKPDDIDATNALGYTLADADR
DLPEAEKLIQTARAAKPNDPAIADSWGWLQYRLGHLDQAEQTLRAAWQARKDADVGVHLG
EVLWKQGRQSDAQHVFDEVRRIDPKSSTLHDTLKRLNP