Protein Info for ABZR86_RS22035 in Dyella japonica UNC79MFTsu3.2

Annotation: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00583: Acetyltransf_1
  • amino acids 37 to 136 (100 residues), 54 bits, E=5.1e-18
• PF13508: Acetyltransf_7
  • amino acids 52 to 138 (87 residues), 57.1 bits, E=4.9e-19
• PF13673: Acetyltransf_10
  • amino acids 54 to 141 (88 residues), 29.9 bits, E=1.3e-10
• TIGR00154: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
  • amino acids 179 to 453 (275 residues), 264.3 bits, E=8.5e-83
• PF00288: GHMP_kinases_N
  • amino acids 261 to 318 (58 residues), 62.8 bits, 8.3e-21
• PF08544: GHMP_kinases_C
  • amino acids 377 to 432 (56 residues), 42.1 bits, 2.3e-14

Predicted SEED Role

"4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC 2.7.1.148)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 2.7.1.148)

MetaCyc Pathways

• methylerythritol phosphate pathway II (8/9 steps found)
• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (10/12 steps found)
• taxadiene biosynthesis (engineered) (10/13 steps found)
• methylerythritol phosphate pathway I (7/9 steps found)
• isoprene biosynthesis I (7/10 steps found)
• superpathway of ergosterol biosynthesis II (9/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.148

Sequence Analysis Tools

See A0A1I2JTC8 at UniProt or InterPro

Protein Sequence (460 amino acids)

>ABZR86_RS22035 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase (Dyella japonica UNC79MFTsu3.2)
MSYSIQRAVPAQVEALCAIERDAMELFRGHRAWRFYAPVTMPPELLRLATERGLVWVAVS
DATGEPVGFVWLDTEDEAGIGLAEIDVLPDWGGKGIGAALLEHACAWARAAGYRQITLGT
LADVPWNAPFYAKHGFVEVDKRDPAFAFARERDLENGFPDDLRVFMSRTLEPPGPEGWTV
WPAPAKLNLFLRITGRRPDGYHELQTVFRLLDWGDEVRLRPRLDGVVRRLTEVPGVPEEQ
DLAVRAARLLQPHAPAGAGVEIEVEKRIPIGGGLGGGSSDAATVLVALNHLWGAGLSEDE
LAGLGRQLGADVPVFVRGRSAWAEGVGDRLQPIVLPQRWYVVVDPREQVPTAELFQASEL
TRNAPPATISSFASGETAENVFEPVVRARHPRVAAALGWLNEFGRARLSGSGGCVFLETK
SQERAEFVAEKCPPSCSAHVAVGVERSPLQEALARHRGAA