Protein Info for ABZR86_RS22000 in Dyella japonica UNC79MFTsu3.2

Annotation: acyl-CoA thioesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 PF03061: 4HBT" amino acids 22 to 96 (75 residues), 66.5 bits, see alignment E=2.2e-22 PF13279: 4HBT_2" amino acids 47 to 124 (78 residues), 27.7 bits, see alignment E=3.2e-10

Best Hits

KEGG orthology group: None (inferred from 59% identity to xal:XALc_2449)

Predicted SEED Role

"cytosolic long-chain acyl-CoA thioester hydrolase family protein" in subsystem Serine-glyoxylate cycle

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2JQR0 at UniProt or InterPro

Protein Sequence (162 amino acids)

>ABZR86_RS22000 acyl-CoA thioesterase (Dyella japonica UNC79MFTsu3.2)
MSGTQHEVSFRFLAQPTDVNFGGKVHGGMAMKWIDQAGYACAVAWSGAYCVTASVSGIQF
VAPILIGDLVTVRARLIHTGRSSMHMAVDVLARDLRKDEHRLATSCVMVFVALDSPEGKP
TPVPVWEPRDEAERQLQAQAKRLMDLSKEMEQLIDAKALADG