Protein Info for ABZR86_RS21925 in Dyella japonica UNC79MFTsu3.2

Annotation: 30S ribosomal protein S7

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00177: Ribosomal_S7
  • amino acids 1 to 148 (148 residues), 202.8 bits, E=1.1e-64
• TIGR01029: ribosomal protein uS7
  • amino acids 3 to 155 (153 residues), 211.7 bits, E=2.6e-67

Best Hits

Swiss-Prot: 83% identical to RS7_XANCB: 30S ribosomal protein S7 (rpsG) from Xanthomonas campestris pv. campestris (strain B100)

KEGG orthology group: K02992, small subunit ribosomal protein S7 (inferred from 83% identity to xal:XALc_0510)

MetaCyc: 61% identical to 30S ribosomal subunit protein S7 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S7p (S5e)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

See A0A1I2K2K0 at UniProt or InterPro

Protein Sequence (155 amino acids)

>ABZR86_RS21925 30S ribosomal protein S7 (Dyella japonica UNC79MFTsu3.2)
MSRKGSHPARLVLPDPKHGSQLIARFINMVMKSGKKSVAESIVYGALDHLGEKHAEPVSL
VEKALNNIAPAVEVKSRRVGGATYQVPVEVRSGRRMALAMRWAIESARKRGETSMPRKLA
AELLEASENRGGAIKKREETHRMAEANKAFSHYRW