Protein Info for ABZR86_RS21595 in Dyella japonica UNC79MFTsu3.2

Annotation: UMP kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 TIGR02075: UMP kinase" amino acids 7 to 238 (232 residues), 315.1 bits, see alignment E=1.5e-98 PF00696: AA_kinase" amino acids 9 to 216 (208 residues), 108.6 bits, see alignment E=2.1e-35

Best Hits

Swiss-Prot: 77% identical to PYRH_XANOM: Uridylate kinase (pyrH) from Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

KEGG orthology group: K09903, uridylate kinase [EC: 2.7.4.22] (inferred from 77% identity to xop:PXO_01129)

MetaCyc: 58% identical to UMP kinase (Escherichia coli K-12 substr. MG1655)
Cytidylate kinase. [EC: 2.7.4.14, 2.7.4.22]

Predicted SEED Role

"Uridine monophosphate kinase (EC 2.7.4.22)" (EC 2.7.4.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.4.14

Use Curated BLAST to search for 2.7.4.14 or 2.7.4.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2IWF7 at UniProt or InterPro

Protein Sequence (240 amino acids)

>ABZR86_RS21595 UMP kinase (Dyella japonica UNC79MFTsu3.2)
MSEPLKYRRILLKLSGEALMGEADYGIDPKVIGRLADEIIDIQKAGVQIGVVIGGGNIFR
GAGLAAAGMDRVTGDHMGMLATVMNALAMQDAIERRGGFARVMSAIQIHDVAEDFIRRRA
IRHIEKGRIALFAAGTGNPFFTTDSAAALRAVEIGADLLLKATKVDGVYTADPARHADAT
RYDRLTYDQVIERKLAVMDTAAIALCRDHGMPLRIYDMTVPGNLLRIMRGESIGTIVTDR