Protein Info for ABZR86_RS21555 in Dyella japonica UNC79MFTsu3.2

Annotation: DUF2165 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 signal peptide" amino acids 1 to 42 (42 residues), see Phobius details transmembrane" amino acids 65 to 84 (20 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 138 to 157 (20 residues), see Phobius details PF09933: DUF2165" amino acids 4 to 158 (155 residues), 212.5 bits, see alignment E=1.8e-67

Best Hits

KEGG orthology group: None (inferred from 59% identity to gbe:GbCGDNIH1_0313)

Predicted SEED Role

"probable membrane protein YPO0899"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2IZ54 at UniProt or InterPro

Protein Sequence (164 amino acids)

>ABZR86_RS21555 DUF2165 family protein (Dyella japonica UNC79MFTsu3.2)
MPARYAKLLLVAGLALLVSLVAFGNLTDYGSNFAFVHHVLAMDTIFPDATIRYRAITAPW
LQHAAYALIIATQLATAVLLWAGAWRMWSRRRAPMALFRRAKGLATAGLSLGVLLWLVGF
MAIGGEWFGMWMSSQWNGIETSFRLVALLLGALIYLGQQEAEPE