Protein Info for ABZR86_RS21505 in Dyella japonica UNC79MFTsu3.2

Annotation: 8-oxo-dGTP diphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 PF00293: NUDIX" amino acids 8 to 134 (127 residues), 69.5 bits, see alignment E=1.5e-23

Best Hits

Swiss-Prot: 38% identical to MUTX_STRPN: 8-oxo-dGTP diphosphatase (mutX) from Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)

KEGG orthology group: K03574, 7,8-dihydro-8-oxoguanine triphosphatase [EC: 3.6.1.-] (inferred from 81% identity to psu:Psesu_1252)

Predicted SEED Role

"Mutator mutT protein (7,8-dihydro-8-oxoguanine-triphosphatase) (EC 3.6.1.-)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2IU70 at UniProt or InterPro

Protein Sequence (162 amino acids)

>ABZR86_RS21505 8-oxo-dGTP diphosphatase (Dyella japonica UNC79MFTsu3.2)
MPYTPIVATLGYVLSPDRRRVLMIHRNARQDDLHLGKYNGLGGKMEPGEDIAACMRREIH
EEAGIECASMQLRGTLNWPGFGKHGEDWLGFIFVIDRYSGEPFASNPEGTLEWVELDRLM
ELPMWEGDRHFLPLVFDGDPRPFHGVMPYKDGRMQSWAFSRL