Protein Info for ABZR86_RS21420 in Dyella japonica UNC79MFTsu3.2

Annotation: alpha/beta fold hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 transmembrane" amino acids 84 to 100 (17 residues), see Phobius details amino acids 127 to 137 (11 residues), see Phobius details PF12146: Hydrolase_4" amino acids 13 to 251 (239 residues), 74.8 bits, see alignment E=1.4e-24 PF00561: Abhydrolase_1" amino acids 16 to 110 (95 residues), 31.9 bits, see alignment E=2.2e-11 PF12697: Abhydrolase_6" amino acids 17 to 252 (236 residues), 45 bits, see alignment E=4.3e-15

Best Hits

KEGG orthology group: K03928, carboxylesterase [EC: 3.1.1.1] (inferred from 66% identity to xal:XALc_1776)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2BGU7 at UniProt or InterPro

Protein Sequence (280 amino acids)

>ABZR86_RS21420 alpha/beta fold hydrolase (Dyella japonica UNC79MFTsu3.2)
MIQNVEFRLEGGRAGVMLIHGLTGTPAEMRLVGRGLNRAGFDVYGMQLAGHCGDADDLIA
TGWKDWYASVQAAAERYAQELDHLFVAGLSMGAVLALKLAADRPDLVKGVGVYGATFRYD
GWATPWYSKLSFMLPLIGRLGLGKHRMVHENEPYGLRDERIRAQVSAQMLGGDSAAAGLP
GNPWPSLAQMYEMAAVVKRDLPKVTAPCLIAHAVEDDIASLENARLVERAVSGPVEMLLL
EDSYHMITIDRERRLLIDRSADFFGRVADPAAAAAARAAA