Protein Info for ABZR86_RS21360 in Dyella japonica UNC79MFTsu3.2

Annotation: cell division topological specificity factor MinE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 94 TIGR01215: cell division topological specificity factor MinE" amino acids 1 to 82 (82 residues), 88.1 bits, see alignment E=1.5e-29 PF03776: MinE" amino acids 14 to 81 (68 residues), 76.1 bits, see alignment E=8.3e-26

Best Hits

Swiss-Prot: 58% identical to MINE_STRM5: Cell division topological specificity factor (minE) from Stenotrophomonas maltophilia (strain R551-3)

KEGG orthology group: K03608, cell division topological specificity factor (inferred from 57% identity to xal:XALc_0893)

Predicted SEED Role

"Cell division topological specificity factor MinE" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2BH87 at UniProt or InterPro

Protein Sequence (94 amino acids)

>ABZR86_RS21360 cell division topological specificity factor MinE (Dyella japonica UNC79MFTsu3.2)
MGILDFLKRRPEPSAVVAKERLRIIVAQERSTRGAPDYLPLLRNELLEVIKKYVHVDIEA
ININVERDSGHEILELSVALPENSKPGSTAPVAG