Protein Info for ABZR86_RS21340 in Dyella japonica UNC79MFTsu3.2

Annotation: sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 46 to 63 (18 residues), see Phobius details amino acids 78 to 98 (21 residues), see Phobius details amino acids 103 to 129 (27 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details PF07730: HisKA_3" amino acids 202 to 265 (64 residues), 58.8 bits, see alignment E=6.6e-20 PF02518: HATPase_c" amino acids 304 to 389 (86 residues), 28.1 bits, see alignment E=2.5e-10

Best Hits

Predicted SEED Role

"two-component system sensor protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2BKE3 at UniProt or InterPro

Protein Sequence (409 amino acids)

>ABZR86_RS21340 sensor histidine kinase (Dyella japonica UNC79MFTsu3.2)
MAWSNINHIRLLRYAGLTTYLCVALPLLPGSWSLARVSSWWSNPNISGWVFSYLMFGVTY
VLLTRSSTLNRQEGLPTISRLMGLTVLTVSAIAMGWFSQSGLSAMLMLVIAVVLPWQLPA
GMGLVWMLLQNLMLIPIIANYREWTLIQAVLQVCMYLAISALVYFTSMIASQQAEEREIQ
RRLNSELRATRALLAESTRIAERMRIARDLHDLVGHHLTALSLNLEVASHLSNPAAAEHV
LKAQATAKHLLRDVREVVSELRQDDAIDLTQALRSLVEGVPGLNVHVETPPRFSVEDPRR
AQVLLRVAQEIITNTARHAGARNLWLDFAYDEAGLLELHARDDGRGADQFRPGNGLSGMR
ERLAEFGGTVNVDTAAGQGFALNVSLPLGEESALAHAPTRFEPPALSVS