Protein Info for ABZR86_RS21335 in Dyella japonica UNC79MFTsu3.2

Annotation: response regulator transcription factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 PF00072: Response_reg" amino acids 4 to 116 (113 residues), 102.6 bits, see alignment E=1.4e-33 PF00196: GerE" amino acids 151 to 206 (56 residues), 69.7 bits, see alignment E=1.2e-23

Best Hits

Swiss-Prot: 39% identical to YXJL_BACSU: Uncharacterized transcriptional regulatory protein YxjL (yxjL) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 76% identity to xcv:XCV1261)

Predicted SEED Role

"Two-component system regulatory protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2BHW2 at UniProt or InterPro

Protein Sequence (213 amino acids)

>ABZR86_RS21335 response regulator transcription factor (Dyella japonica UNC79MFTsu3.2)
MISVCLVDDQNLVRQGVRSLLDLAEDIRVVAECADGAQAVQDIPRIKPDVVLLDLRMPNM
SGLEVLQALSARNELPPTIILTTFDDDQLVLQGLKAGARGYLLKDVSLEQLVEAVRTVAA
GGSLVAPMVTQRLLAGVGRMQNQFTSLEQPDPLTERETEILRLLSGGYSNKEIANSLKVA
EGTVKNHVSNILSKLGVRDRTRAVLKALELGIV