Protein Info for ABZR86_RS21315 in Dyella japonica UNC79MFTsu3.2

Annotation: GldG family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 631 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 602 to 621 (20 residues), see Phobius details PF09822: ABC_transp_aux" amino acids 38 to 318 (281 residues), 209 bits, see alignment E=4.8e-66

Best Hits

Predicted SEED Role

"gliding motility protein GldG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2BIB1 at UniProt or InterPro

Protein Sequence (631 amino acids)

>ABZR86_RS21315 GldG family protein (Dyella japonica UNC79MFTsu3.2)
MRRLTFTRRVRVIGLLVLLVAVSVTLAMAGSRWMRATRFDLTSDRLYTLTPGTVRIVDKL
RAPLRLTLYFSEHSTRDLPQLRSYEQRVRELLQEMVARSHGRLRLQVVDPVPYSDDEAAA
EGNGLSPLSGGTNGERVFFGLVGTTLPGTQDGEADNETRPGAKTLAIPLFDPGRETFLEY
DVAKLLYELNEPAKPHIGVISSLAVQGNPVLGEEPWTVIRQLGQLFEVKTLDPNKLDRVG
DDIQVLLLIHPKHLSESALYAIDQYVLRGGHLVAFVDPYSELDTTPFVDSNGVIDDHDSD
LRRLFDAWGVQFDPQKVVLDRSRALRIELADNSAANHPAMLGLTGQELNHGDVTTASLQR
INLSSVGYLDLSPKATSRLIPLMQTSTDAEVVPAQRVREATTDPNALLDGYKADNTRYVV
AARVRGAFTSAFPERAKQPGYIAQAKGNAEVVLVADTDLLTDRLWVSYSQSLLGPLQLSA
LANNGDFVTNLADNLSGSSELLSIRGRTSSQRPFTRVQALQAAADQKFLAKKQELQRELA
VTRSRLSELQPAKAARGDNAGSEQRTEIEQFLQRQLAINKELRDVQHQLNGEIDALGMRL
KFLNIVLVPALVTLFGLAYGWRRSRRNRRRA