Protein Info for ABZR86_RS21310 in Dyella japonica UNC79MFTsu3.2

Annotation: cytochrome c oxidase assembly protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 transmembrane" amino acids 14 to 32 (19 residues), see Phobius details amino acids 44 to 61 (18 residues), see Phobius details amino acids 81 to 104 (24 residues), see Phobius details amino acids 124 to 145 (22 residues), see Phobius details amino acids 157 to 177 (21 residues), see Phobius details amino acids 189 to 212 (24 residues), see Phobius details amino acids 238 to 260 (23 residues), see Phobius details PF09678: Caa3_CtaG" amino acids 27 to 264 (238 residues), 170.4 bits, see alignment E=2.3e-54

Best Hits

KEGG orthology group: K02351, putative membrane protein (inferred from 57% identity to brh:RBRH_03659)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2BL53 at UniProt or InterPro

Protein Sequence (284 amino acids)

>ABZR86_RS21310 cytochrome c oxidase assembly protein (Dyella japonica UNC79MFTsu3.2)
MMTSLLKWIVPWEFSWVFLLSFAAICVLYVRGCARLPVSGGRRLAFWTGMAIVYVSLHTY
FDYYAEHEFFMHRIQQVLLHHLAPLLLVGSYPGTVLRAGLPLAWRARALRPLERSWPWRA
MTGVLLNPAVATVLFVGFILIWLIPSMQTLAMLDWRIYRFMNWTMMLSGLSYWWLVLDHR
PRPPGRMTPGLRVLSPAITMSPQILAGAIVTFSKTDLYPIFEICGRAFTFNVLTGQLAGG
VIMWVPAAMIESIGGLLALRQWVRLSRNGRIKSKRQLQLERRLG