Protein Info for ABZR86_RS21290 in Dyella japonica UNC79MFTsu3.2

Annotation: CPBP family glutamic-type intramembrane protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 transmembrane" amino acids 14 to 36 (23 residues), see Phobius details amino acids 47 to 72 (26 residues), see Phobius details amino acids 99 to 118 (20 residues), see Phobius details amino acids 149 to 167 (19 residues), see Phobius details amino acids 173 to 196 (24 residues), see Phobius details amino acids 206 to 225 (20 residues), see Phobius details amino acids 233 to 254 (22 residues), see Phobius details PF02517: Rce1-like" amino acids 133 to 241 (109 residues), 42.3 bits, see alignment E=3.8e-15

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2BIW7 at UniProt or InterPro

Protein Sequence (255 amino acids)

>ABZR86_RS21290 CPBP family glutamic-type intramembrane protease (Dyella japonica UNC79MFTsu3.2)
MPALPATRAPRLKLALALGIASAIATLALFPYLIVLMPRLTRLPISVPLLAITQSLQAGA
LCGVLAWLGLWLGERYGLGAPWLRAWIYREAPPPARGKWLWAVLLGIVSAVLVLALDWHG
QVHAPASRLLDQAWRGALASFYGGIAEETQCRLFLMSLLLWLLARVGGGVRPWMYGAAIV
LAALLFGAGHLPAAFSAGMAHGPLSIGRIILLNALVGLPFGWLFWKYGLEHAMVAHFSAD
LVLHVGAQLALAALA