Protein Info for ABZR86_RS21170 in Dyella japonica UNC79MFTsu3.2

Annotation: copper resistance system multicopper oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 569 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details TIGR01480: copper-resistance protein, CopA family" amino acids 10 to 568 (559 residues), 870.4 bits, see alignment E=3.3e-266 PF07732: Cu-oxidase_3" amino acids 62 to 169 (108 residues), 125.1 bits, see alignment E=2.4e-40 amino acids 461 to 568 (108 residues), 32 bits, see alignment E=1.8e-11 PF00394: Cu-oxidase" amino acids 178 to 351 (174 residues), 82.2 bits, see alignment E=7e-27 PF07731: Cu-oxidase_2" amino acids 456 to 568 (113 residues), 104.5 bits, see alignment E=6.1e-34

Best Hits

KEGG orthology group: None (inferred from 60% identity to sch:Sphch_4196)

Predicted SEED Role

"Multicopper oxidase" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2BLJ6 at UniProt or InterPro

Protein Sequence (569 amino acids)

>ABZR86_RS21170 copper resistance system multicopper oxidase (Dyella japonica UNC79MFTsu3.2)
MNKQYPHGIHLPRRRFVQGLALGGVAAGLGLWRGDALAQLAAAPRAELSGTHFELEIGEL
PVDFTGRRRIATVVNGQLPAPLLRWRQGDTVTLRVRNRLAVASSVHWHGIVLPADMDGVP
GISFDGIAPGGEYLYRFTVNQAGTYWYHSHSRFQEQVGLYGPIVIEPRDGERHVAQRDYT
ILLSEWTDTDPERIYANLKKQSDYYNLGKRTAGDFLRDMRRQGLGDALAERRMWQQMRMD
PTDLADVSAMAYTYLVNGSTPAGNWTGLFDAGEKVRLRFINGSSMSFFDVRIPGLKMTVI
AADGQPVEPITVDEFRIGTAETYDVMVEPSADRAWTIFAQSMDRSGYARATLAPRAGMAA
EVPPLDPRPLLGMGDMMGSMGHGGTGHDMGGMSHTGHETGSMPVLNTGVEVDMRVPQPRR
NLDDPGVGLRDTGRRALTYADLHAVDAPISPEVDRELTLRLTGNMERYLWSFDGTRFSNA
QPLHLKHGERVRITLVNDTMMTHPIHLHGMWSELENEAGGFQVRKHTVVVQPAQQLSYRV
NADAVGRWAYHCHLLYHMEAGMFREVVVA