Protein Info for ABZR86_RS21075 in Dyella japonica UNC79MFTsu3.2

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 6 to 185 (180 residues), 144.1 bits, E=7.7e-46
• PF08659: KR
  • amino acids 9 to 115 (107 residues), 30.3 bits, E=7.8e-11
• PF01370: Epimerase
  • amino acids 9 to 104 (96 residues), 21.3 bits, E=3.2e-08
• PF13561: adh_short_C2
  • amino acids 12 to 232 (221 residues), 155.4 bits, E=4e-49

Best Hits

KEGG orthology group: None (inferred from 75% identity to bja:blr5937)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (48/53 steps found)
• palmitate biosynthesis III (28/29 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• anteiso-branched-chain fatty acid biosynthesis (30/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (30/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (30/34 steps found)
• tetradecanoate biosynthesis (mitochondria) (23/25 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (12/12 steps found)
• biotin biosynthesis I (14/15 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (17/20 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
• 8-amino-7-oxononanoate biosynthesis I (10/11 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
• fatty acid elongation -- saturated (5/5 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• (5Z)-dodecenoate biosynthesis I (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
• cis-vaccenate biosynthesis (4/5 steps found)
• (5Z)-dodecenoate biosynthesis II (4/6 steps found)
• stearate biosynthesis IV (4/6 steps found)
• petroselinate biosynthesis (2/6 steps found)
• 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• mycolate biosynthesis (25/205 steps found)
• superpathway of mycolate biosynthesis (26/239 steps found)

KEGG Metabolic Maps

• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

See A0A1I2BNV0 at UniProt or InterPro

Protein Sequence (236 amino acids)

>ABZR86_RS21075 SDR family oxidoreductase (Dyella japonica UNC79MFTsu3.2)
MNSQQKVAIVTGASQGIGASLVKALRDRNYRVVANSRSIQPSSDPDVIAVPGDIAERAVA
ERIVAQALERFGRIDTLVNNAGIFTAKPFAAFTADDYAANIAVNLTGFFHITQLAIAEME
KQGSGHVVSITTSLTDHAVDGVPSALASLTKGGLNSATKSLAIEYAKRGVRVNAVSPGVI
KTPMHPMETHGFLAALHPVGRMGEVADIVDAVLYLDSAGFVTGEILHVDGGQSAGH