Protein Info for ABZR86_RS20915 in Dyella japonica UNC79MFTsu3.2

Annotation: DNA-3-methyladenine glycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 TIGR00567: DNA-3-methyladenine glycosylase" amino acids 21 to 207 (187 residues), 175.9 bits, see alignment E=3.3e-56 PF02245: Pur_DNA_glyco" amino acids 25 to 203 (179 residues), 209.6 bits, see alignment E=1.3e-66

Best Hits

Swiss-Prot: 78% identical to 3MGH_BURCA: Putative 3-methyladenine DNA glycosylase (Bcen_2161) from Burkholderia cenocepacia (strain AU 1054)

KEGG orthology group: K03652, DNA-3-methyladenine glycosylase [EC: 3.2.2.21] (inferred from 78% identity to bch:Bcen2424_2775)

Predicted SEED Role

"DNA-3-methyladenine glycosylase II (EC 3.2.2.21)" in subsystem DNA Repair Base Excision (EC 3.2.2.21)

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.21

Use Curated BLAST to search for 3.2.2.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2BRX2 at UniProt or InterPro

Protein Sequence (221 amino acids)

>ABZR86_RS20915 DNA-3-methyladenine glycosylase (Dyella japonica UNC79MFTsu3.2)
MTETPVARRKTTSIAWPGTPLPRAFFDRPSTLLAPLLLNKILAAADGRAGRIVEVEAYAG
AVDPAAHTYRGKTARNATMFGPPGHLYVYFTYGMHWCANCVAGPEGAGGAVLIRALEPLH
GLAQMRAARPRASVDRDLCRGPARLTQAMGISGAQDGIDLVAALEGFTVVDDGTAPPGDP
QVGPRIGISVAKDFPWRWCVPGNRHVSGSATLRSCARTRQE