Protein Info for ABZR86_RS20770 in Dyella japonica UNC79MFTsu3.2

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 40 to 357 (318 residues), 202.4 bits, see alignment E=4.3e-64 PF16576: HlyD_D23" amino acids 59 to 261 (203 residues), 45.7 bits, see alignment E=7.3e-16 PF13533: Biotin_lipoyl_2" amino acids 67 to 108 (42 residues), 31.7 bits, see alignment 1.5e-11 PF13437: HlyD_3" amino acids 173 to 263 (91 residues), 31.2 bits, see alignment E=4.6e-11

Best Hits

KEGG orthology group: None (inferred from 81% identity to bug:BC1001_4645)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2BVG7 at UniProt or InterPro

Protein Sequence (371 amino acids)

>ABZR86_RS20770 efflux RND transporter periplasmic adaptor subunit (Dyella japonica UNC79MFTsu3.2)
MFRLRFATPAVVLVLTFALAACGGKAPADPRTDAPLVRVAAVQSALPAMRSFTGTVAARV
QSDLGFRVAGKVLQRLVDAGQSVKRGQPLMRIDPVDLKLAAQARQEAVAAARARARQTAE
DEARYGDLRGTGAISASAYDQVKAAADAAKAQLSAAEADANVANNASGYAELVADGDGVV
METLAEPGQVVGAGQTVVRLAHAGPREAVVQLPETLRPAIGSAAQAALFGKEGISAPATL
RQLSDAADPLTRTFEARYVLQGELASASLGTTVTIRLPSGHADTQGDLQVPLGALFDAGK
GPGVWVIGGEPAKVSWRPVVLRHLDDDRARIAGQLKQGDRVVALGAHLLREGEPVRVASQ
VAAAANEGGQP