Protein Info for ABZR86_RS20600 in Dyella japonica UNC79MFTsu3.2

Annotation: ferrous iron transporter B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 618 transmembrane" amino acids 221 to 242 (22 residues), see Phobius details amino acids 248 to 265 (18 residues), see Phobius details amino acids 277 to 302 (26 residues), see Phobius details amino acids 324 to 345 (22 residues), see Phobius details amino acids 357 to 382 (26 residues), see Phobius details amino acids 394 to 416 (23 residues), see Phobius details amino acids 454 to 475 (22 residues), see Phobius details amino acids 498 to 518 (21 residues), see Phobius details amino acids 525 to 541 (17 residues), see Phobius details amino acids 553 to 571 (19 residues), see Phobius details amino acids 592 to 613 (22 residues), see Phobius details PF01926: MMR_HSR1" amino acids 7 to 124 (118 residues), 63.4 bits, see alignment E=4.2e-21 PF02421: FeoB_N" amino acids 7 to 166 (160 residues), 176.4 bits, see alignment E=6.1e-56 PF07670: Gate" amino acids 285 to 380 (96 residues), 73 bits, see alignment E=4.9e-24 amino acids 455 to 589 (135 residues), 64.9 bits, see alignment E=1.7e-21 PF07664: FeoB_C" amino acids 398 to 450 (53 residues), 54.3 bits, see alignment 1.7e-18

Best Hits

KEGG orthology group: K04759, ferrous iron transport protein B (inferred from 79% identity to har:HEAR1502)

Predicted SEED Role

"Ferrous iron transport protein B" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2BZH8 at UniProt or InterPro

Protein Sequence (618 amino acids)

>ABZR86_RS20600 ferrous iron transporter B (Dyella japonica UNC79MFTsu3.2)
MSATTLRIALVGNPNCGKTALFNQLTGGRQKVANYAGVTVERKEGRFTAPSGRVLHLLDL
PGTYSFDANSPDEQITRDVCEGVYPGEPAPDLIVCVADATNLRLHLRFVLEVKRLGRPVV
LALNMMDTARRRGIRIDVAGLQQRLGIPVVETVAVKRGGAKALIERVDGEVPEAAPAQPD
DPASRADLHAQVRELLAATVVMPRNTDAIDDALDRWALHPVFGLGILAVLMFLIFQAVFS
WAQPVMDAIAAGVAALGGWVTGALPQGSALHSLLNDGVFAGLGAVLVFLPQILILFLFIL
VLEESGYLPRAAFLLDKLMFKAGLTGRAFIPLLSSFACAIPGIMATRSITDPRDRLTTIL
VAPLMTCSARLPVYTLLIAAFIPQRTVWGLFNLQGIVLFTLYVAGIVSALSVAFVIKRFR
KDKSEHALLMELPSYRLPNPRDIALGLWERALIFLKRVGGIILALTVLLWFLSSFPAPPE
GATQPAIDYSLAGRLGRLLHYVFAPIGFNWQICIALIPGLAAREVAVSALGTVYAMSAAG
GDDALASQLGPVIAQQWSLATALSLLAWYVFAPQCMSTMAVIRRETNSWRNVAITAGYLF
GLAYLASLITYQVARALA