Protein Info for ABZR86_RS20555 in Dyella japonica UNC79MFTsu3.2

Annotation: isovaleryl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 PF02771: Acyl-CoA_dh_N" amino acids 8 to 119 (112 residues), 142.2 bits, see alignment E=1.8e-45 PF02770: Acyl-CoA_dh_M" amino acids 123 to 220 (98 residues), 84.5 bits, see alignment E=9.7e-28 PF00441: Acyl-CoA_dh_1" amino acids 232 to 380 (149 residues), 127.1 bits, see alignment E=1.3e-40 PF08028: Acyl-CoA_dh_2" amino acids 253 to 364 (112 residues), 39.7 bits, see alignment E=1.1e-13

Best Hits

Swiss-Prot: 65% identical to IVD_SOLTU: Isovaleryl-CoA dehydrogenase, mitochondrial (IVD) from Solanum tuberosum

KEGG orthology group: None (inferred from 79% identity to psu:Psesu_1634)

MetaCyc: 63% identical to isovaleryl-CoA dehydrogenase subunit (Pseudomonas aeruginosa PAO1)
RXN0-2301 [EC: 1.3.8.4]

Predicted SEED Role

"Isovaleryl-CoA dehydrogenase (EC 1.3.8.4)" (EC 1.3.8.4)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.8.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2C0D3 at UniProt or InterPro

Protein Sequence (385 amino acids)

>ABZR86_RS20555 isovaleryl-CoA dehydrogenase (Dyella japonica UNC79MFTsu3.2)
MRPFSLGEELDLLRESVHAFAEKEIAPRATQIDHDNVFPADLWRKFGEMGLLGMTIPEAY
GGTGLGYLAHMVAMEEISRASGSVGLSYGAHSNLCVQNLFHNGNEEQRRKYIPRLCSGEY
VGALAMSEPGAGSDVVGSMSCKAELRGDVWVANGTKMWITNGPDADVLLVYMRTAPRPAG
SRCMTAFIIEKGMKGFSTAQKLDKLGMRGSNTCELVFEDCEIPAANIVGEVNEGVRVLMS
GLDTERLVLSGGPLGLMQAAMDLVLPYVRERKQFNAPIGTFGMMQAKVADMYTALQSSRG
FAYMVAREFDQGSKSRIDPAACLLNASQNAVKVALEAIQALGGNGYINEFPAGRLLRDAK
LYEIGAGTNEIRRMLIGRELYHGKS