Protein Info for ABZR86_RS20485 in Dyella japonica UNC79MFTsu3.2

Annotation: FAD/NAD(P)-binding oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 5 to 291 (287 residues), 113.8 bits, see alignment E=4.3e-36 PF03486: HI0933_like" amino acids 5 to 40 (36 residues), 26.4 bits, see alignment 1.2e-09 PF00890: FAD_binding_2" amino acids 6 to 42 (37 residues), 25.1 bits, see alignment 4.1e-09 PF12831: FAD_oxidored" amino acids 6 to 43 (38 residues), 30.6 bits, see alignment 9.8e-11 PF13450: NAD_binding_8" amino acids 9 to 46 (38 residues), 29.3 bits, see alignment 3.4e-10

Best Hits

KEGG orthology group: None (inferred from 64% identity to xcb:XC_1700)

Predicted SEED Role

"Putative oxidoreductase in 4-hydroxyproline catabolic gene cluster" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2C1T2 at UniProt or InterPro

Protein Sequence (428 amino acids)

>ABZR86_RS20485 FAD/NAD(P)-binding oxidoreductase (Dyella japonica UNC79MFTsu3.2)
MTERYDVLVVGAGPAGLAAAGTAAAHGARVGLLDAQPRAGGQVWRHDVRKNAPRAAREAI
AALHGVTLLAQHSVIASEDGALRVEIPQGSTLLTYGALVLATGARELLLPFPGWTLPGVS
GAGGLQALTKQGWPVAGKRVVVAGSGPLLLAAAATLRAHGAKLVGIHEQASAESVHAFAR
QLLHWPARATQAALLRAKLAGVPYRFGSVVRQAHGEDALRLVEIDGAHGTSLVDCDLLAV
GYGLVPNVELAQLLGCALDHGHPHPHVQVDELLRTSVPAILAAGEACGIGGLAVARIEGA
IAGHMAAGHQDDARALLPERDRARRFGALLARHFAPGARVHALATPQTLICRCEDVPLGA
LDGYADARDAKLATRCGMGACQGRICGTALAELGRFPRGAGRPPLFPARLATLAGLALSS
SDASRSST