Protein Info for ABZR86_RS20320 in Dyella japonica UNC79MFTsu3.2

Annotation: aldo/keto reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 PF00248: Aldo_ket_red" amino acids 15 to 312 (298 residues), 253.5 bits, see alignment E=1.2e-79

Best Hits

Swiss-Prot: 57% identical to YAJO_ECOLI: 1-deoxyxylulose-5-phosphate synthase YajO (yajO) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 65% identity to sro:Sros_5690)

MetaCyc: 57% identical to 1-deoxyxylulose-5-phosphate synthase YajO (Escherichia coli K-12 substr. MG1655)
1.17.1.-

Predicted SEED Role

"L-fuco-beta-pyranose dehydrogenase (EC 1.1.1.122)" (EC 1.1.1.122)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.122

Use Curated BLAST to search for 1.1.1.122

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2C5B3 at UniProt or InterPro

Protein Sequence (323 amino acids)

>ABZR86_RS20320 aldo/keto reductase (Dyella japonica UNC79MFTsu3.2)
MQYVNLGRSGLKVSRLCLGAMSYGDPHAKPWILSEEQGRPILRRALELGINFFDTADMYS
GGESERVLGRALRDFARREEVVVATKAYYPTSPGPNQRGLSRKHLLHAIDASLTRLGMDY
VDLYQIHRWDDETPLEETLETLHDIVRSGKARYIGASSMYAWQFQKALMTAERQGWTRFI
SMQNHYNLVYREEEREMLPLCRDAGIGVLPWSPLARGFLARPRDNVATVRAQSDVFGQGL
YYSEDDYRVVDAVAALAEERRVPQAQIALAWLLSRTGMSAPIIGATRKDQLEQAVEAVGL
TLAEEDCARLEAPYRPHRVLGHE