Protein Info for ABZR86_RS20265 in Dyella japonica UNC79MFTsu3.2

Annotation: RNA polymerase sigma factor FliA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 16 to 236 (221 residues), 113.2 bits, see alignment E=9.8e-37 PF04542: Sigma70_r2" amino acids 18 to 91 (74 residues), 67.3 bits, see alignment E=1.7e-22 TIGR02479: RNA polymerase sigma factor, FliA/WhiG family" amino acids 18 to 237 (220 residues), 271.7 bits, see alignment E=5.2e-85 PF04539: Sigma70_r3" amino acids 98 to 172 (75 residues), 35.7 bits, see alignment E=1.5e-12 PF08281: Sigma70_r4_2" amino acids 181 to 222 (42 residues), 28.1 bits, see alignment 2.6e-10 PF04545: Sigma70_r4" amino acids 186 to 235 (50 residues), 60.2 bits, see alignment 2.2e-20

Best Hits

Swiss-Prot: 36% identical to RPSD_BACSU: RNA polymerase sigma-D factor (sigD) from Bacillus subtilis (strain 168)

KEGG orthology group: K02405, RNA polymerase sigma factor for flagellar operon FliA (inferred from 60% identity to nwa:Nwat_0930)

Predicted SEED Role

"RNA polymerase sigma factor for flagellar operon" in subsystem Flagellar motility or Flagellum or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2I1N8 at UniProt or InterPro

Protein Sequence (259 amino acids)

>ABZR86_RS20265 RNA polymerase sigma factor FliA (Dyella japonica UNC79MFTsu3.2)
MSVASEYLQLQRESTEEMVRRHAPLVRRIAYHLMGRLPPSVDVDDLVQAGMIGLLEAARN
YATDRMASFETYAGIRIRGAMLDELRKTDWTPRSVHRKLREVSEVVRQIENETGADATDA
EVIRRLGIDAQEYHQILADAASARLLSLSAPEDDEDGAALDVADQEGLGPQDRFEQEGMR
GALVEAIGGLPEREQLVMSLYYEQELNLKEIGAVLGVTESRVCQIHGQALIRLRARMTGW
REQGAAADSSKARKLKSTG