Protein Info for ABZR86_RS20245 in Dyella japonica UNC79MFTsu3.2

Annotation: flagellar biosynthesis protein FlhB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 transmembrane" amino acids 33 to 50 (18 residues), see Phobius details amino acids 90 to 116 (27 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details amino acids 191 to 211 (21 residues), see Phobius details PF01312: Bac_export_2" amino acids 7 to 347 (341 residues), 405.4 bits, see alignment E=1.1e-125 TIGR00328: flagellar biosynthetic protein FlhB" amino acids 7 to 352 (346 residues), 391.8 bits, see alignment E=1.5e-121

Best Hits

KEGG orthology group: K02401, flagellar biosynthetic protein FlhB (inferred from 45% identity to pap:PSPA7_3878)

Predicted SEED Role

"Flagellar biosynthesis protein FlhB" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2I559 at UniProt or InterPro

Protein Sequence (377 amino acids)

>ABZR86_RS20245 flagellar biosynthesis protein FlhB (Dyella japonica UNC79MFTsu3.2)
MSESDDQERTEKPSEKRLREAREKGDVPRSRDLSGALVVLAGVAALMSGSERAFVHARRI
YELGFGYSREALFSGELPARVLGAALREAIALITPVALATLLATFAAPTLLGGLSFSAQA
LQPKFDRLDPIAGLGRLVSMRGLVELVKSLLKLLFIGAALAWFLWRGQAAMQASGRGTVG
AGIALSLSQLGNAALLFGTMLALIGGIDAAYQRYDYGKRLRMTKQEVRDENKESEGNPEL
KGRIRQVQHQLARRRMMQELPKADVVVTNPTHFAVALKYDENRMRAPRVIAKGVDVLAMQ
IRQAAAGHRIPMVEAPPLARALYATTELGREIPAALYVAVAQVLAYVFQLRQAVAHGDAP
PVPPSPQVDPDLLGPYR