Protein Info for ABZR86_RS20240 in Dyella japonica UNC79MFTsu3.2

Annotation: flagellar biosynthetic protein FliR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 42 to 61 (20 residues), see Phobius details amino acids 73 to 98 (26 residues), see Phobius details amino acids 126 to 146 (21 residues), see Phobius details amino acids 177 to 200 (24 residues), see Phobius details amino acids 212 to 232 (21 residues), see Phobius details PF01311: Bac_export_1" amino acids 15 to 241 (227 residues), 212.5 bits, see alignment E=3.4e-67 TIGR01400: flagellar biosynthetic protein FliR" amino acids 16 to 254 (239 residues), 202.8 bits, see alignment E=3.3e-64

Best Hits

Swiss-Prot: 41% identical to FLIR_PECCC: Flagellar biosynthetic protein FliR (fliR) from Pectobacterium carotovorum subsp. carotovorum

KEGG orthology group: K02421, flagellar biosynthetic protein FliR (inferred from 44% identity to alv:Alvin_2927)

Predicted SEED Role

"Flagellar biosynthesis protein FliR" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2I536 at UniProt or InterPro

Protein Sequence (256 amino acids)

>ABZR86_RS20240 flagellar biosynthetic protein FliR (Dyella japonica UNC79MFTsu3.2)
MNTLDLAQLPVLLGSVLWAMGRVAGLFLVAPVFGATVLPARIRVGLIVLLTLVLAPLAPA
RVDPMSSTGVSTMAGQVLIGAAVGFVLRLTFEAVAFGGQLVAQSMSLGFAEVVNPQGGGS
SPVLNQFYLLLVTLLFLAMDGHLRLIELLADSFRTLPPGAGAISPDGLHAVALFGGQLFA
GAVRVALPAMTALLVVNMGFGAISRAAPSMNLFAVGFPITLCLGFIALWLSLRALPGAFG
SLEESAWSLMRELLGQ