Protein Info for ABZR86_RS20110 in Dyella japonica UNC79MFTsu3.2

Annotation: flagellar basal body P-ring protein FlgI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details PF02119: FlgI" amino acids 17 to 361 (345 residues), 480 bits, see alignment E=1.9e-148

Best Hits

Swiss-Prot: 62% identical to FLGI_NITOC: Flagellar P-ring protein (flgI) from Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / NCIMB 11848 / C-107)

KEGG orthology group: K02394, flagellar P-ring protein precursor FlgI (inferred from 62% identity to nhl:Nhal_2331)

Predicted SEED Role

"Flagellar P-ring protein FlgI" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2I3H6 at UniProt or InterPro

Protein Sequence (362 amino acids)

>ABZR86_RS20110 flagellar basal body P-ring protein FlgI (Dyella japonica UNC79MFTsu3.2)
MLFFALLFLAASVHADKIRDLAQVAGVRSNQLIGYGLVVGLDGSGDQTTQAPFTTQSLEN
MLQQFGITVPANVRPQLKNAAAVTVTAQLPPFAKPGQAIDVTVASIGNAKSIRGGELLMT
PLRGADGNVYAMAQGSVVVGGISAQGKSGSSVQVNISASGRVPNGATVERSVASSFGQGG
DLVLNLNTPDFTTAARIAEAVNRAYGAGTAQPVDGGSVAVRGPADPAQRVSWLGMIQALE
VQPGDAPARVVVNSRTGTVVIGSEVKVSAAAVAHGSIQVTISEQPQVSQPAPFSRGGQTV
VVPSSSVQVSEDGAHMFKFGPGASLDSIVRAVNQVGASPTDLISILQALKQAGALHAELV
VI