Protein Info for ABZR86_RS20095 in Dyella japonica UNC79MFTsu3.2

Annotation: flagellar basal-body rod protein FlgF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 TIGR03506: flagellar hook-basal body protein" amino acids 4 to 121 (118 residues), 120.7 bits, see alignment E=1.2e-38 TIGR02490: flagellar basal-body rod protein FlgF" amino acids 5 to 223 (219 residues), 198.2 bits, see alignment E=1.3e-62 PF00460: Flg_bb_rod" amino acids 5 to 35 (31 residues), 25.4 bits, see alignment 1.7e-09 PF22692: LlgE_F_G_D1" amino acids 81 to 146 (66 residues), 60 bits, see alignment E=3e-20 PF06429: Flg_bbr_C" amino acids 198 to 242 (45 residues), 61.4 bits, see alignment 7e-21

Best Hits

Swiss-Prot: 45% identical to FLGF_SALTY: Flagellar basal-body rod protein FlgF (flgF) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02391, flagellar basal-body rod protein FlgF (inferred from 50% identity to noc:Noc_2374)

Predicted SEED Role

"Flagellar basal-body rod protein FlgF" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2HZX3 at UniProt or InterPro

Protein Sequence (246 amino acids)

>ABZR86_RS20095 flagellar basal-body rod protein FlgF (Dyella japonica UNC79MFTsu3.2)
MDRSIYVAMTGATQMMRAQTEVAHNLANADTVGFKAQMSAFKPLPVQGQGLGSRINGVAQ
GIGWDMHAGAQMDTGRPLDVAVQGDGWMAVQSADGGEGYTRAGQLQLTADGLLTDARGNP
VLGDGGPITVPDATQVSIGADGTISVVPKGQGPDTSSVIGKLKLVKPASDQLQLGDDGLM
HLAGGGVAPADETVTVKAGALESSNVNPSQTLVQMIQLSRQYELQVRAIRTADDNAQSAT
RLLQVG