Protein Info for ABZR86_RS19990 in Dyella japonica UNC79MFTsu3.2

Annotation: 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 TIGR00095: 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD" amino acids 5 to 184 (180 residues), 164.9 bits, see alignment E=8.8e-53 PF03602: Cons_hypoth95" amino acids 8 to 181 (174 residues), 176.4 bits, see alignment E=4.9e-56 PF05175: MTS" amino acids 48 to 127 (80 residues), 24.8 bits, see alignment E=1.6e-09

Best Hits

Swiss-Prot: 54% identical to RSMD_ECOL6: Ribosomal RNA small subunit methyltransferase D (rsmD) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K08316, ribosomal RNA small subunit methyltransferase D [EC: 2.1.1.171] (inferred from 53% identity to cja:CJA_3501)

MetaCyc: 54% identical to 16S rRNA m2G966 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-6515 [EC: 2.1.1.171]

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.171

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2I0Q5 at UniProt or InterPro

Protein Sequence (186 amino acids)

>ABZR86_RS19990 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD (Dyella japonica UNC79MFTsu3.2)
MSGASGRIRIIGGTLRNSRLDVPDLPGLRPTAERVRETLFNWLAPVIAGAQCLDLCAGTG
ALGIEALSRGAGRTQFVERDPRAAQALRDNLVRLKAAGGEVATADAGAYLHGAARPYGVV
FLDPPFALELWEALARRLEEGGWLAPSAWIYVESPRGKALALPPAWRLHREGQAGEVRYA
LHRRVA