Protein Info for ABZR86_RS19930 in Dyella japonica UNC79MFTsu3.2

Annotation: YbaL family putative K(+) efflux transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 552 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 31 to 50 (20 residues), see Phobius details amino acids 56 to 76 (21 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details amino acids 226 to 246 (21 residues), see Phobius details amino acids 252 to 268 (17 residues), see Phobius details amino acids 280 to 298 (19 residues), see Phobius details amino acids 303 to 327 (25 residues), see Phobius details amino acids 334 to 356 (23 residues), see Phobius details amino acids 368 to 387 (20 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 12 to 385 (374 residues), 240.8 bits, see alignment E=2.2e-75 PF02254: TrkA_N" amino acids 422 to 536 (115 residues), 86.8 bits, see alignment E=1.4e-28

Best Hits

KEGG orthology group: K03455, monovalent cation:H+ antiporter-2, CPA2 family (inferred from 58% identity to rlt:Rleg2_0292)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2I3B7 at UniProt or InterPro

Protein Sequence (552 amino acids)

>ABZR86_RS19930 YbaL family putative K(+) efflux transporter (Dyella japonica UNC79MFTsu3.2)
MHDAPLIGTIVGGIVLAFFFAAIAHRLRLPALAGYLLAGVVCGPFTPGFVADGHLAHQLA
EIGVVLLMFGVGLHFSLKDLLSVKSIAIPGALGQMAVATVLGMLLGWALDWPLVQSFVFG
LALSVASTVVLLRAMEERRLMETERGRIAVGWLIVEDLAMVLALVLLPAIGASLNAGQSM
SFGEIAVTVGMTIGKVVAFVAVMLIVGKRLIPWLLQVIAQTGSRELFRLAVLAIALGVAF
GAAGLFGVSFELGAFFAGMMMGESKLAHDAAEETLPLRDAFAVLFFVSIGMLFNYQVLLA
EPLVVLAALAIIVIGKSVAALGIVLAFRKPLTTALTIATSLAQIGEFSFILIGVGVAQNL
VSKEAQDVLLAAAILSILINPLLFKLLDRAKARLDARAAPSEEAQGGIAAEPLQPTALRG
HVVVAGYGRLGQLLGEAVHATGVPLLVLEEEKDHVDALRQQGIETLVGNASSDEVLDAAN
LPEAKALLVTLPQAFESGEVVRAARQLNPALRIIVRADSEECREHLQKQGADLVVMGERE
LARAMTEGLAPA