Protein Info for ABZR86_RS19925 in Dyella japonica UNC79MFTsu3.2

Annotation: DNA helicase RecQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 603 TIGR01389: ATP-dependent DNA helicase RecQ" amino acids 7 to 601 (595 residues), 828.9 bits, see alignment E=2.3e-253 TIGR00614: ATP-dependent DNA helicase, RecQ family" amino acids 7 to 456 (450 residues), 523.5 bits, see alignment E=5.3e-161 PF00270: DEAD" amino acids 21 to 183 (163 residues), 90.6 bits, see alignment E=2.4e-29 PF00271: Helicase_C" amino acids 217 to 321 (105 residues), 62.9 bits, see alignment E=8.2e-21 PF16124: RecQ_Zn_bind" amino acids 335 to 397 (63 residues), 71.4 bits, see alignment E=2.1e-23 PF09382: RQC" amino acids 399 to 509 (111 residues), 132.5 bits, see alignment E=1.6e-42 PF00570: HRDC" amino acids 535 to 599 (65 residues), 77 bits, see alignment E=2.3e-25

Best Hits

Swiss-Prot: 50% identical to RECQ_ECOLI: ATP-dependent DNA helicase RecQ (recQ) from Escherichia coli (strain K12)

KEGG orthology group: K03654, ATP-dependent DNA helicase RecQ [EC: 3.6.4.12] (inferred from 67% identity to psu:Psesu_0686)

MetaCyc: 50% identical to ATP-dependent DNA helicase RecQ (Escherichia coli K-12 substr. MG1655)
RXN-11135 [EC: 5.6.2.4]

Predicted SEED Role

"ATP-dependent DNA helicase RecQ" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.12

Use Curated BLAST to search for 3.6.4.12 or 5.6.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2I036 at UniProt or InterPro

Protein Sequence (603 amino acids)

>ABZR86_RS19925 DNA helicase RecQ (Dyella japonica UNC79MFTsu3.2)
MPSSPLDILHSVFGYTSFRGQQQAIVEQVAEGGDALVLMPTGGGKSLCYQIPALLRQGTG
IVVSPLIALMQDQVDALREAGVAAAYLNSSLSAEDQREVERQLLAGELNLLYVAPERLLT
GRFLGLLERTEVALFAIDEAHCVSQWGHDFRPEYRELAVLHQRFPQVPRIALTATADPRT
REEIVERLALQDARQFLSSFDRPNIRYRAGLRHNAKRQLTDFLEGHRGEAGIVYCLSRRK
VDETAAWLVESGIAALPYHAGLDAATRAANQQRFLREDGVVMVATVAFGMGIDKPDVRFV
AHLDLPRSMEGYYQETGRAGRDSLPAEAWMIYGLSDVVTMSQMIAQSESADERKRVERQK
LESLLAFAEATECRRERLLGAFGETYHGPCGNCDNCLEPPKTWDATVPSQKALSAVYRSG
QRFGSGHVIDILRGVDSERMSQLRHDHLSTFGIGADMDEKQWRSVFRQLLAAGLLEAEGE
YGTLRLTRSSREVLTGNRQVLLREDTRPERRSRRRRDSQLVTGSSLGIEAYEQPMWDALR
ALRAKLAKQHGVPAYVIFHDATLLSMLRELPANEEEMASISGVGEAKLKRYGQDFLAVIN
AQE