Protein Info for ABZR86_RS19910 in Dyella japonica UNC79MFTsu3.2

Annotation: inorganic phosphate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 42 to 60 (19 residues), see Phobius details amino acids 72 to 97 (26 residues), see Phobius details amino acids 105 to 127 (23 residues), see Phobius details amino acids 145 to 173 (29 residues), see Phobius details amino acids 189 to 208 (20 residues), see Phobius details amino acids 219 to 238 (20 residues), see Phobius details amino acids 257 to 280 (24 residues), see Phobius details amino acids 296 to 316 (21 residues), see Phobius details amino acids 347 to 367 (21 residues), see Phobius details PF01384: PHO4" amino acids 18 to 361 (344 residues), 294.8 bits, see alignment E=4.1e-92

Best Hits

KEGG orthology group: K03306, inorganic phosphate transporter, PiT family (inferred from 59% identity to psu:Psesu_1861)

Predicted SEED Role

"Probable low-affinity inorganic phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2I1J4 at UniProt or InterPro

Protein Sequence (372 amino acids)

>ABZR86_RS19910 inorganic phosphate transporter (Dyella japonica UNC79MFTsu3.2)
MSMVLAVVLIALVFTYINGFHDTANSIATVVATKVLTPGQAVILAAITNLIGALWGTAVA
KTIAAGLIDTSVVAAGSQLLICALGAATVWNLITWWLGLPSSSSHALVGALVGAAIAASG
DNFASIIWSQGGAHWWQGKGVIPKVVVPMVVSPLLGFVIGFLLMGALYALLGWFSGRQGF
LRRFGRTPFVNSFFGKAQIVSASAMGLAHGMNDAQKSMGIIALALAGATAAGQFDGLPSW
LGFLRIHGSATGGFDVPAWVAVVCALTMAGGTAGGGWRIIKTLGHKMVKLHPINGFAAEG
SSAAVILTASVLGVPVSTTHNVSASIMGVGAAKRWNAIRWSVVERMVWAWILTLPVTALL
AYGGVRLAQALL